Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD)

This Recombinant Human LITAF domain-containing protein (LITAD) spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Large Multifunctional Peptidase 2 ELISA Kit
MBS049980-01 48 Well

Mouse Large Multifunctional Peptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Large Multifunctional Peptidase 2 ELISA Kit
MBS049980-02 96 Well

Mouse Large Multifunctional Peptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Large Multifunctional Peptidase 2 ELISA Kit
MBS049980-03 5x 96 Well

Mouse Large Multifunctional Peptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Large Multifunctional Peptidase 2 ELISA Kit
MBS049980-04 10x 96 Well

Mouse Large Multifunctional Peptidase 2 ELISA Kit

Sign In for Pricing
View Details
3-Hydrazinotetrahydrothiophene-1-dioxide hydrochloride
OR0505 1 Each

3-Hydrazinotetrahydrothiophene-1-dioxide hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Cd164 shRNA (UAS) - Lentiviral mouse Cd164 shRNA (UAS, RFP) (100)
GTR15253800 1 Vial

Lentiviral mouse Cd164 shRNA (UAS) - Lentiviral mouse Cd164 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details