Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD)

This Recombinant Human LITAF domain-containing protein (LITAD) spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL1 antibody - middle region (ARP32100_T100)
ARP32100_T100 100 µL

DVL1 antibody - middle region (ARP32100_T100)

Sign In for Pricing
View Details
Rabbit Polyclonal Thymidine Kinase 1 Antibody [DyLight 680]
NB100-60644FR 0.1 mL

Rabbit Polyclonal Thymidine Kinase 1 Antibody [DyLight 680]

Sign In for Pricing
View Details
ADAM6B Lentiviral Activation Particles (m)
sc-433629-LAC 200 µL

ADAM6B Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Pigp 3'UTR GFP Stable Cell Line
TU166356 1.0 mL

Pigp 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum DXR Protein (aa 73-488) (isolate 3D7)
VAng-Wyb6416-1mgEcoli 1 mg (E. coli)

Recombinant Plasmodium Falciparum DXR Protein (aa 73-488) (isolate 3D7)

Sign In for Pricing
View Details
C2orf44 Polyclonal Antibody, RBITC Conjugated
bs-9814R-RBITC 100 µL

C2orf44 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details