Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline rich transmembrane protein 1B (PRT1B), partial

This Recombinant Human Proline rich transmembrane protein 1B (PRT1B), partial spans the amino acid sequence from region 1-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline rich transmembrane protein 1B PRRT1B IFITMD8

UniProt

A0A1B0GWB2

Expression Region

1-189

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEAGAGGAGSDTKGGGSPATPEDPRSPAKPAAPEDPQMPAQPALPQLPRRPRTLDEDGAPSEDGAAGGSEPAPEDAPAQAAGEAGPVSKAAAGGAPHIGFVGEPPPYAPPDPKAAPLLYPPFPQVPVVLQPAPSALFPPPAQLYPAAPTPPALFSPPAGAAFPFPVYNGPMAGVPGPATVEHRPLPKDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP5C antibody
MBS832105-01 0.1 mL

PPP5C antibody

Sign In for Pricing
View Details
PPP5C antibody
MBS832105-02 5x 0.1 mL

PPP5C antibody

Sign In for Pricing
View Details
MCF2L Knockout Cell Line-HeLa
RK-0600 1x 10^6

MCF2L Knockout Cell Line-HeLa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS617792 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
ESM-1 HDR Plasmid (h2)
sc-403120-HDR-2 20 µg

ESM-1 HDR Plasmid (h2)

Sign In for Pricing
View Details
CS1 HDR Plasmid (m)
sc-429061-HDR 20 µg

CS1 HDR Plasmid (m)

Sign In for Pricing
View Details