Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF647 conjugate, 0.1mg/mL
BNC470923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF488A conjugate, 0.1mg/mL
BNC881909-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details