Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HO1 Recombinant Protein
OPCD03941-10UG 10 µg

HO1 Recombinant Protein

Sign In for Pricing
View Details
Pig Osteopontin (OPN) ELISA Kit
AE15023PI-01 48 Tests

Pig Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
Pig Osteopontin (OPN) ELISA Kit
AE15023PI-02 96 Tests

Pig Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
POLE4 antibody
70R-35516 0.1 mg

POLE4 antibody

Sign In for Pricing
View Details
QDPR, CT (Quinoid Dihydropteridine Reductase, HDHPR, Dihydropteridine Reductase, DHPR) (PE) discontinued
Q1085-01-PE 200 µL

QDPR, CT (Quinoid Dihydropteridine Reductase, HDHPR, Dihydropteridine Reductase, DHPR) (PE) discontinued

Sign In for Pricing
View Details
ICOS (h) : 293T Lysate
sc-114660 100 µg - 200 µL

ICOS (h) : 293T Lysate

Sign In for Pricing
View Details