Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 14 (TFKLN)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 14 (TFKLN) spans the amino acid sequence from region 1-197. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 14 TAF11L14

UniProt

A0A1W2PPL8

Expression Region

1-197

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMFAIPRGLKGCNEDGIPEALDGNLEEPRAQECELRSEDVMDLTVVDNEASASAPPAAKRQKTDTKGQKERKPSVDAEEAQRMTTLLSAMSEEQLSRYEVCRQLAFPKALVARLMWSITGRSVPENMAIAMAGIAKVFVGEVVEEALDMCEMWGEMPPLQPMDLREAVCRLKPKGLFPNNYKKVMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCO4 Antibody - C-terminal region : Biotin (ARP55797_P050-Biotin)
ARP55797_P050-Biotin 100 µL

TMCO4 Antibody - C-terminal region : Biotin (ARP55797_P050-Biotin)

Sign In for Pricing
View Details
LNP (LNPK) Human Gene Knockout Kit (CRISPR)
KN413378 1 Kit

LNP (LNPK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DGK-θ (S725) polyclonal antibody
BS2479-01 50 µL

DGK-θ (S725) polyclonal antibody

Sign In for Pricing
View Details
DGK-θ (S725) polyclonal antibody
BS2479-02 100 µL

DGK-θ (S725) polyclonal antibody

Sign In for Pricing
View Details
DDX28 Antibody - N-terminal region
ARP36457_P050-25UL 25 µL

DDX28 Antibody - N-terminal region

Sign In for Pricing
View Details
DFHBI-1T
B2799-1 1 mg

DFHBI-1T

Sign In for Pricing
View Details