Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 4 (SCGR4)

This Recombinant Human Small cysteine and glycine repeat-containing protein 4 (SCGR4) spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 4; Keratin-associated protein 28-4; SCYGR4 KRTAP28-4

UniProt

A0A286YEV6

Expression Region

1-105

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGGCGGRCGGGCGGGCSGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCGSCGCGYGKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 540 Anti-non-human primates/ human CD49b Antibody *AK7*
10491121-AAT 500 Tests

MFluor™ Violet 540 Anti-non-human primates/ human CD49b Antibody *AK7*

Sign In for Pricing
View Details
OR13I1P 3'UTR Luciferase Stable Cell Line
TU017032 1.0 mL

OR13I1P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lamin B2 Polyclonal Antibody, PE Conjugated
bs-11132R-PE 100 µL

Lamin B2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 405) discontinued
D4012-02-ML405 100 µL

DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
N-Oleoyl glycine
M26577-01 1 g

N-Oleoyl glycine

Sign In for Pricing
View Details
N-Oleoyl glycine
M26577-02 500 mg

N-Oleoyl glycine

Sign In for Pricing
View Details