Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5)

This Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5) spans the amino acid sequence from region 1-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 5; Keratin-associated protein 28-5; SCYGR5 KRTAP28-5

UniProt

A0A286YF46

Expression Region

1-85

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCCSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details