Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5)

This Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5) spans the amino acid sequence from region 1-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 5; Keratin-associated protein 28-5; SCYGR5 KRTAP28-5

UniProt

A0A286YF46

Expression Region

1-85

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCCSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial
MBS9423790-01 0.02 mg

Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Sign In for Pricing
View Details
Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial
MBS9423790-02 0.1 mg

Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Sign In for Pricing
View Details
Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial
MBS9423790-03 1 mg

Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Sign In for Pricing
View Details
Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial
MBS9423790-04 5x 1 mg

Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Sign In for Pricing
View Details
Mouse Gdap1l1 activation kit by CRISPRa
GA214042 1 Kit

Mouse Gdap1l1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat M-Phase Phosphoprotein 8 (MPHOSPH8) ELISA Kit
MBS9360835-01 48 Well

Rat M-Phase Phosphoprotein 8 (MPHOSPH8) ELISA Kit

Sign In for Pricing
View Details