Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 271 (TM271), partial

This Recombinant Human Transmembrane protein 271 (TM271), partial spans the amino acid sequence from region 240-385. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 271 TMEM271

UniProt

A0A286YF58

Expression Region

240-385

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNYKSSQARRGRRGRRRGGRALARPRGGSGLRAQPPASRARRGRRGRRGRRLQQRPSEASILSPEESDLAAPGDCAGFAAHHAVSYINVGVLHALDEAGAEVRCGGHPSVELPGYAPSDPDLNASYPYCCRPPCETPRPWETHRAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reproterol-d3 (Major)
TRC-R144652-1MG 1 mg

Reproterol-d3 (Major)

Sign In for Pricing
View Details
Y-27632 Dihydrochloride
TRC-D455443-50MG 50 mg

Y-27632 Dihydrochloride

Sign In for Pricing
View Details
COX19 (NM_001031617) Human Over-expression Lysate
LC422214 20 µg

COX19 (NM_001031617) Human Over-expression Lysate

Sign In for Pricing
View Details
Ornithine Decarboxylase (ODC1) Rabbit Monoclonal Antibody
TA423861 100 µL

Ornithine Decarboxylase (ODC1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CaSR Recombinant Rabbit monoclonal Antibody
HA750881 100 µL

CaSR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Hexanoic-4,4,5,5,6,6,6-d7 Acid
TRC-H292152-2.5MG 2.5 mg

Hexanoic-4,4,5,5,6,6,6-d7 Acid

Sign In for Pricing
View Details