Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7215354-01 48 Well

Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7215354-02 96 Well

Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7215354-03 5x 96 Well

Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7215354-04 10x 96 Well

Goat Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
INPP4B Recombinant Antibody, HRP Conjugated
bsm-61303R-HRP-TR 20 µL

INPP4B Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
BLOC1S5 (FITC)
556508-01 50 µg

BLOC1S5 (FITC)

Sign In for Pricing
View Details