Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4A (OSP4A)

This Recombinant Human Oocyte-secreted protein 4A (OSP4A) spans the amino acid sequence from region 20-184. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4A OOSP4A

UniProt

A0A2R8YFL7

Expression Region

20-184

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LQDLSITCSESWLQVKLRRTPLLNDLQPLQNELSLGIGCPVNMVEVDFFGFLYLLTFCGIRVSEHGVGILIESLIVYEPTNFDFNLHIPVSCYVQRRFPIILVMRGRENDSRRECRRSVGQHRSLSHELEDLEIRPRVSYVNSVPLLSYLIVSLPKCKNKAVHSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp2a5 (NM_007812) Mouse Untagged Clone
MC216788 10 µg

Cyp2a5 (NM_007812) Mouse Untagged Clone

Sign In for Pricing
View Details
RHOJ Rabbit pAb
A20762 50 µL

RHOJ Rabbit pAb

Sign In for Pricing
View Details
Human S100A1 activation kit by CRISPRa
GA104249 1 Kit

Human S100A1 activation kit by CRISPRa

Sign In for Pricing
View Details
SECTM1 (NM_003004) Human Untagged Clone
SC118235 10 µg

SECTM1 (NM_003004) Human Untagged Clone

Sign In for Pricing
View Details
KIAA1751 (CFAP74) (NM_001080484) Human Tagged ORF Clone Lentiviral Particle
RC221579L3V 200 µL

KIAA1751 (CFAP74) (NM_001080484) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RNASE1 Rabbit Polyclonal Antibody
R1109 2 mL

RNASE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details