Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial

This Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial spans the amino acid sequence from region 1756-1817. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative PWWP domain-containing DNA repair factor 4 PWWP4

UniProt

A0A494C071

Expression Region

1756-1817

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGIQVPLRRLKHLDCKEKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat cytovillin/ezrin, CVL ELISA Kit
YLA1049RA-01 48 Tests

Rat cytovillin/ezrin, CVL ELISA Kit

Sign In for Pricing
View Details
Rat cytovillin/ezrin, CVL ELISA Kit
YLA1049RA-02 96 Tests

Rat cytovillin/ezrin, CVL ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Slc4a4 shRNA (UAS) - Lentiviral mouse Slc4a4 shRNA (UAS, RFP) plasmid
GTR15287077 1 Vial

Lentiviral mouse Slc4a4 shRNA (UAS) - Lentiviral mouse Slc4a4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
NCKPL, ID (NCKAP1L, HEM1, Nck-associated protein 1-like, Hematopoietic protein 1, Membrane-associated protein HEM-1) (FITC) discontinued
038832-FITC 200 µL

NCKPL, ID (NCKAP1L, HEM1, Nck-associated protein 1-like, Hematopoietic protein 1, Membrane-associated protein HEM-1) (FITC) discontinued

Sign In for Pricing
View Details
Amphotericin B, Solubilized
A-561-250-500mg 500 mg

Amphotericin B, Solubilized

Sign In for Pricing
View Details
Human UGT2B4 Pre-designed siRNA Set A
SI017814A 1 Each

Human UGT2B4 Pre-designed siRNA Set A

Sign In for Pricing
View Details