Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E21 (SPD21)

This Recombinant Human Speedy protein E21 (SPD21) spans the amino acid sequence from region 1-402. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E21 SPDYE21

UniProt

A0A494C086

Expression Region

1-402

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRTETRFRKRGQITGKITTSRQLHPQNEQSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVLLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIVYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYGKTRSRIPLLRKRWFQLGRSMNPRARKNRSRIPLLRKRRFQLGRSMNPRARKYRSRIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKLRFQFFCSMSGRAWVSPEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optitrol NAT SARS-CoV-2
NT04031 5x 0.6 mL

Optitrol NAT SARS-CoV-2

Sign In for Pricing
View Details
Ccdc58 (BC024862) Mouse Tagged ORF Clone
MG200939 10 µg

Ccdc58 (BC024862) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant PRMT5 Monoclonal Antibody
AN301635L-01 50 µL

Recombinant PRMT5 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PRMT5 Monoclonal Antibody
AN301635L-02 100 µL

Recombinant PRMT5 Monoclonal Antibody

Sign In for Pricing
View Details
Arf1 (NM_007476) Mouse Tagged ORF Clone
MG201636 10 µg

Arf1 (NM_007476) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SOD2 Polyclonal Antibody
AN006910L-01 25 µL

SOD2 Polyclonal Antibody

Sign In for Pricing
View Details