Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142)

This Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC02881; Long intergenic non-protein coding RNA 2881; LINC02881 C10orf142

UniProt

B7Z368

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB538899 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
IFluor® 450 Anti-human CD4 Antibody *SK3*
10042040-AAT 100 Tests

IFluor® 450 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
DNP Tyramide
#96019 1x 500 µg

DNP Tyramide

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF568 conjugate, 0.1mg/mL
BNC683149-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPS25 Mouse Monoclonal Antibody [Clone ID: AT38E7]
AM50043PU-N 100 µL

MRPS25 Mouse Monoclonal Antibody [Clone ID: AT38E7]

Sign In for Pricing
View Details
Epsin 2 (EPN2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E4]
TA504302AM 100 µL

Epsin 2 (EPN2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E4]

Sign In for Pricing
View Details