Recombinant Human UBAP1-MVB12-associated (UMAD1)
This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS
UniProt
C9J7I0
Expression Region
1-137
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC419604 20 µg
CD89 (FCAR) (NM_002000) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC471902-100 1x 100 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH031161 50 µg
Recombinant Human Semaphorin 5A/SEMA5A Protein (aa 1-968, His Tag)
Sign In for Pricing
View Details 
![p60 CAF1 Recombinant Rabbit Monoclonal Antibody [JG92-30]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81002/imageurl/et7108-85.webp)
ET7108-85 100 µL
p60 CAF1 Recombinant Rabbit Monoclonal Antibody [JG92-30]
Sign In for Pricing
View Details