Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBAP1-MVB12-associated (UMAD1)

This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS

UniProt

C9J7I0

Expression Region

1-137

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD0328
HY-116507 1 Each

AZD0328

Sign In for Pricing
View Details
Polyclonal PKD1 (aa2281-2292) Antibody (C-Term)
AMR09305G 0.1 mg

Polyclonal PKD1 (aa2281-2292) Antibody (C-Term)

Sign In for Pricing
View Details
Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)
MBS717615-01 0.02 mg (E-Coli)

Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)

Sign In for Pricing
View Details
Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)
MBS717615-02 0.1 mg (E-Coli)

Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)

Sign In for Pricing
View Details
Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)
MBS717615-03 0.02 mg (Yeast)

Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)

Sign In for Pricing
View Details
Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)
MBS717615-04 0.1 mg (Yeast)

Recombinant Rat C-X-C motif chemokine 2 (Cxcl2)

Sign In for Pricing
View Details