Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp3 shRNA (UAS) - Lentiviral mouse Zfp3 shRNA (UAS, GFP) plasmid
GTR15227758 1 Vial

Lentiviral mouse Zfp3 shRNA (UAS) - Lentiviral mouse Zfp3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2)
MBS6334235-01 0.2 mL

PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2)

Sign In for Pricing
View Details
PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2)
MBS6334235-02 5x 0.2 mL

PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2)

Sign In for Pricing
View Details
LUZP4 ORF Vector (Human) (pORF)
ORF013723 1.0 µg DNA

LUZP4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque HEXIM1 Protein, His (Fc)-Avi-tagged
HEXIM1-1892R 50 µg

Recombinant Rhesus Macaque HEXIM1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PYK2 Antibody (phospho Tyr402)
GWB-6E6731 0.05 mL

PYK2 Antibody (phospho Tyr402)

Sign In for Pricing
View Details