Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2)

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 550)
MBS6486304-01 0.1 mL

MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 550)

Sign In for Pricing
View Details
MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 550)
MBS6486304-02 5x 0.1 mL

MAGEA12, NT (Melanoma-associated Antigen 12, MAGE-12 Antigen, MAGE-12F Antigen, Cancer/Testis Antigen 1.12, CT1.12, MAGE12) (MaxLight 550)

Sign In for Pricing
View Details
CD1A Antibody (FITC)
orb1272162 25 Tests

CD1A Antibody (FITC)

Sign In for Pricing
View Details
NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (PE) discontinued
039201-PE 200 µL

NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (PE) discontinued

Sign In for Pricing
View Details
2-[2-[2- (2-t-Boc-aminoethoxy]ethoxy]ethoxy]-4-[3- (trifluoromethyl) -3H-diazirin-3-yl]benzoic acid methyl ester
262909-01 2 mg

2-[2-[2- (2-t-Boc-aminoethoxy]ethoxy]ethoxy]-4-[3- (trifluoromethyl) -3H-diazirin-3-yl]benzoic acid methyl ester

Sign In for Pricing
View Details
2-[2-[2- (2-t-Boc-aminoethoxy]ethoxy]ethoxy]-4-[3- (trifluoromethyl) -3H-diazirin-3-yl]benzoic acid methyl ester
262909-02 5 mg

2-[2-[2- (2-t-Boc-aminoethoxy]ethoxy]ethoxy]-4-[3- (trifluoromethyl) -3H-diazirin-3-yl]benzoic acid methyl ester

Sign In for Pricing
View Details