Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial
This Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Nuclear pore complex-interacting protein family member B11 NPIPB11
UniProt
E5RHQ5
Expression Region
1-62
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031672-ML490 100 µL
AF4, NT (MLLT2, Mixed Lineage Leukemia, Translocated to, 2, ALL1 fused gene from chromosome 4, AF4, FEL) (MaxLight 490) discontinued
Sign In for Pricing
View Details 