Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial

This Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial spans the amino acid sequence from region 34-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uroplakin-3b-like protein 2 UPK3BL2

UniProt

E5RIL1

Expression Region

34-204

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automatic Sealing And Capping Machine BLIH-103
BLIH-103 1 Unit

Automatic Sealing And Capping Machine BLIH-103

Sign In for Pricing
View Details
TagFP, AlpHcAbs® Rabbit antibody
HA710080 100 µg

TagFP, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
9-BBN Dimer (Technical Grade)
TRC-B119150-5G 5 g

9-BBN Dimer (Technical Grade)

Sign In for Pricing
View Details
Copz1 (BC025041) Mouse Tagged ORF Clone
MG201293 10 µg

Copz1 (BC025041) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Glufosinate
TRC-G596958-1MG 1 mg

Glufosinate

Sign In for Pricing
View Details
CCDC19 (CFAP45) Human Gene Knockout Kit (CRISPR)
KN420922 1 Kit

CCDC19 (CFAP45) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details