Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B12 NPIPB12

UniProt

F8W0I5

Expression Region

1-72

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLHVIIAFPTSYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chp2 Rabbit pAb, AP conjugated
orb2823843 100 µL

Chp2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Pig Interleukin 15 (IL15) ELISA Kit
abx575554 96 Well

Pig Interleukin 15 (IL15) ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-7240-5p miRNA Antagomir
CIN1734-01 10 nmol

Mmu-miR-7240-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7240-5p miRNA Antagomir
CIN1734-02 20 nmol

Mmu-miR-7240-5p miRNA Antagomir

Sign In for Pricing
View Details
Rhox9 (NM_023894) Mouse Tagged ORF Clone Lentiviral Particle
MR202681L4V 200 µL

Rhox9 (NM_023894) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MAP2K2 Mouse Monoclonal Antibody
AMM80817-01 1 Each

MAP2K2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details