Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)

This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079) spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79

UniProt

G3V211

Expression Region

1-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethoxyimidazo[2,1-b][1,3]thiazole-5-carbaldehyde
MMB61711-01 50 mg

6-Ethoxyimidazo[2,1-b][1,3]thiazole-5-carbaldehyde

Sign In for Pricing
View Details
6-Ethoxyimidazo[2,1-b][1,3]thiazole-5-carbaldehyde
MMB61711-02 0.5 g

6-Ethoxyimidazo[2,1-b][1,3]thiazole-5-carbaldehyde

Sign In for Pricing
View Details
PDE7B AAV siRNA Pooled Vector
36296161 1.0 µg

PDE7B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (
MBS6213283-01 0.1 mL

POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (

Sign In for Pricing
View Details
POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (
MBS6213283-02 5x 0.1 mL

POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (

Sign In for Pricing
View Details
Lentiviral mouse Gtf3c5 shRNA (UAS) - Lentiviral mouse Gtf3c5 shRNA (UAS, RFP) (25)
GTR15287903 1 Vial

Lentiviral mouse Gtf3c5 shRNA (UAS) - Lentiviral mouse Gtf3c5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details