Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6L (LY6L)

This Recombinant Human Lymphocyte antigen 6L (LY6L) spans the amino acid sequence from region 17-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6L; Lymphocyte antigen 6 complex locus protein L; LY6L

UniProt

H3BQJ8

Expression Region

17-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAGCATTPARNLSCYQCFKVSSWTECPPTWCSPLDQVCISNEVVVSFKWSVRVLLSKRCAPRCPNDNMKFEWSPAPMVQGVITRRCCSWALCNRALTPQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal SCO1 antibody - middle region
AMR09836G 0.05mg

Polyclonal SCO1 antibody - middle region

Sign In for Pricing
View Details
Goat Cell cycle control protein 50C (TMEM30C) ELISA Kit
GTR10367217 96 Well

Goat Cell cycle control protein 50C (TMEM30C) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Ubiquitin(1-75) protein
RP10083LQ 1 mg

Recombinant Human Ubiquitin(1-75) protein

Sign In for Pricing
View Details
SOCS4 sgRNA CRISPR Lentivector set (Human)
K2257401 3x 1.0 µg

SOCS4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
FTH1 Recombinant Protein (Human)
OPCA00431-1MG 1 mg

FTH1 Recombinant Protein (Human)

Sign In for Pricing
View Details
GSG1 Peptide
MBS3236472-01 0.1 mg

GSG1 Peptide

Sign In for Pricing
View Details