Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small leucine-rich protein 1 (SMLR1), partial

This Recombinant Human Small leucine-rich protein 1 (SMLR1), partial spans the amino acid sequence from region 74-107. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small leucine-rich protein 1 SMLR1

UniProt

H3BR10

Expression Region

74-107

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Caspase-1 Rabbit Monoclonal Antibody
M00048-3-20μl 20 µL

Anti-Caspase-1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DHRS11  polyclonal antibody
BS75864 50ul

DHRS11 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae AIM18 Protein (aa 73-321) [His] (strain RM11-1a)
VAng-Wyb4142-1mg 1 mg

Recombinant Saccharomyces Cerevisiae AIM18 Protein (aa 73-321) [His] (strain RM11-1a)

Sign In for Pricing
View Details
TMX2-CTNND1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47184061 1.0 µg DNA

TMX2-CTNND1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LOC386400 3'UTR GFP Stable Cell Line
TU162354 1.0 mL

LOC386400 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Taselisib (GDC 0032)
S7103-1g 1 g

Taselisib (GDC 0032)

Sign In for Pricing
View Details