Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-Synuclein-alpha (Y136) antibody
STJ90681 200 µl

Anti-Phospho-Synuclein-alpha (Y136) antibody

Sign In for Pricing
View Details
C10orf131 CRISPR Activation Plasmid (h2)
sc-418735-ACT-2 20 µg

C10orf131 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
NFATc1 Double Nickase Plasmid (h)
sc-400164-NIC 20 µg

NFATc1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PNPO Polyclonal Antibody
bs-5108R 100 µL

PNPO Polyclonal Antibody

Sign In for Pricing
View Details
TK2 Adenovirus (Mouse)
46748054 1.0 mL

TK2 Adenovirus (Mouse)

Sign In for Pricing
View Details
BCOX1 Rabbit pAb
E47R16960 100 µL

BCOX1 Rabbit pAb

Sign In for Pricing
View Details