Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sex Determining Region Y Box Protein 15 (SOX15) Antibody
abx026837-01 80 µL

Sex Determining Region Y Box Protein 15 (SOX15) Antibody

Sign In for Pricing
View Details
Sex Determining Region Y Box Protein 15 (SOX15) Antibody
abx026837-02 400 µL

Sex Determining Region Y Box Protein 15 (SOX15) Antibody

Sign In for Pricing
View Details
Complete Medium for Rat Epididymal Epithelial Cells
abx704629-01 100 mL

Complete Medium for Rat Epididymal Epithelial Cells

Sign In for Pricing
View Details
Complete Medium for Rat Epididymal Epithelial Cells
abx704629-02 500 mL

Complete Medium for Rat Epididymal Epithelial Cells

Sign In for Pricing
View Details
GNAT3, ID (GNAT3, Guanine nucleotide-binding protein G(t) subunit alpha-3, Gustducin alpha-3 chain) (MaxLight 405)
MBS6302979-01 0.1 mL

GNAT3, ID (GNAT3, Guanine nucleotide-binding protein G(t) subunit alpha-3, Gustducin alpha-3 chain) (MaxLight 405)

Sign In for Pricing
View Details
GNAT3, ID (GNAT3, Guanine nucleotide-binding protein G(t) subunit alpha-3, Gustducin alpha-3 chain) (MaxLight 405)
MBS6302979-02 5x 0.1 mL

GNAT3, ID (GNAT3, Guanine nucleotide-binding protein G(t) subunit alpha-3, Gustducin alpha-3 chain) (MaxLight 405)

Sign In for Pricing
View Details