Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8 antibody
70R-18194 50 μL

KRT8 antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum aroK Protein (aa 1-184)
VAng-Yyj4308-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Marinum aroK Protein (aa 1-184)

Sign In for Pricing
View Details
KEL AAV siRNA Pooled Vector
25493161 1.0 µg

KEL AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TBK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
SR309210 2 nmol

TBK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Sign In for Pricing
View Details
Human Lipoxin B4 (LXB4) ELISA kit
YLA4386HU-01 48 Tests

Human Lipoxin B4 (LXB4) ELISA kit

Sign In for Pricing
View Details
Human Lipoxin B4 (LXB4) ELISA kit
YLA4386HU-02 96 Tests

Human Lipoxin B4 (LXB4) ELISA kit

Sign In for Pricing
View Details