Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DIS3L2 activation kit by CRISPRa
GA115086 1 Kit

Human DIS3L2 activation kit by CRISPRa

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), Biotin conjugate, 0.1mg/mL
BNCB2378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Butyric-4,4,4-d3 Acid
TRC-B692241-10MG 10 mg

Butyric-4,4,4-d3 Acid

Sign In for Pricing
View Details
Raltitrexed
TRC-R100500-25MG 25 mg

Raltitrexed

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS629154 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
Human FGD5 activation kit by CRISPRa
GA115830 1 Kit

Human FGD5 activation kit by CRISPRa

Sign In for Pricing
View Details