Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMPK gamma 3 (PRKAG3) Rabbit Polyclonal Antibody
AP13603PU-N 400 µL

AMPK gamma 3 (PRKAG3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX2 Antibody
KC-19034-01 50 μL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
KC-19034-02 100 µL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
KC-19034-03 1 mL

STX2 Antibody

Sign In for Pricing
View Details
(4-n-Nonylphenoxy)acetic-Alpha,Alpha-d2 Acid
TRC-N650461-5MG 5 mg

(4-n-Nonylphenoxy)acetic-Alpha,Alpha-d2 Acid

Sign In for Pricing
View Details