Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FP-TZTP, >85%
TRC-F756500-5MG 5 mg

FP-TZTP, >85%

Sign In for Pricing
View Details
Actr1b Mouse Gene Knockout Kit (CRISPR)
KN500790 1 Kit

Actr1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARTS1 (ERAP1) (NM_001040458) Human Over-expression Lysate
LY425713 100 µg

ARTS1 (ERAP1) (NM_001040458) Human Over-expression Lysate

Sign In for Pricing
View Details
TCEAL1 (NM_001006639) Human Over-expression Lysate
LY423535 100 µg

TCEAL1 (NM_001006639) Human Over-expression Lysate

Sign In for Pricing
View Details
Nicocodine (1.0 mg/mL in Acetonitrile)
TRC-KIT8570-5X1ML 5x 1 mL

Nicocodine (1.0 mg/mL in Acetonitrile)

Sign In for Pricing
View Details
Myostatin Propeptide (MSTN) Mouse Monoclonal Antibody [Clone ID: OTI6A7]
CF807790 100 µg

Myostatin Propeptide (MSTN) Mouse Monoclonal Antibody [Clone ID: OTI6A7]

Sign In for Pricing
View Details