Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (2'-Bromophenyl) -3-oxopropanenitrile
265760-01 1 g

3- (2'-Bromophenyl) -3-oxopropanenitrile

Sign In for Pricing
View Details
3- (2'-Bromophenyl) -3-oxopropanenitrile
265760-02 2 g

3- (2'-Bromophenyl) -3-oxopropanenitrile

Sign In for Pricing
View Details
3- (2'-Bromophenyl) -3-oxopropanenitrile
265760-03 5 g

3- (2'-Bromophenyl) -3-oxopropanenitrile

Sign In for Pricing
View Details
3- (2'-Bromophenyl) -3-oxopropanenitrile
265760-04 10 g

3- (2'-Bromophenyl) -3-oxopropanenitrile

Sign In for Pricing
View Details
3- (2'-Bromophenyl) -3-oxopropanenitrile
265760-05 25 g

3- (2'-Bromophenyl) -3-oxopropanenitrile

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ALCAM
MAB-606020232 0.1ml

Mouse Monoclonal Antibody to ALCAM

Sign In for Pricing
View Details