Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25A Rabbit Polyclonal Antibody
AP06379PU-N 100 µg

CDC25A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF640R conjugate, 0.1mg/mL
BNC403126-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Starch Glycolate
TRC-S666990-100MG 100 mg

Sodium Starch Glycolate

Sign In for Pricing
View Details
CCL16 Polyclonal Antibody
E-AB-16304-01 20 µL

CCL16 Polyclonal Antibody

Sign In for Pricing
View Details
CCL16 Polyclonal Antibody
E-AB-16304-02 60 µL

CCL16 Polyclonal Antibody

Sign In for Pricing
View Details
CCL16 Polyclonal Antibody
E-AB-16304-03 120 µL

CCL16 Polyclonal Antibody

Sign In for Pricing
View Details