Recombinant Human Claudin-34 (CLD34), partial
This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Claudin-34 CLDN34
UniProt
H7C241
Expression Region
33-80
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124464-ML405 100 µL
CCL26 (CC Chemokine IMAC, Thymic Stroma Chemokine-1, TSC-1, Macrophage Inflammatory Protein 4-alpha, MIP-4-alpha, Eotaxin-3, Small-inducible Cytokine A26, C-C Motif Chemokine 26, SCYA26, UNQ216/PRO242) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
