Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1)

This Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein PYCARD-AS1; PYCARD antisense RNA 1; PYCARD antisense gene protein 1; PYCARD opposite strand protein; PYCARD-AS1 C16orf98 PYCARDOS

UniProt

I3L0S3

Expression Region

1-204

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRAHVAQHVSGELGAVGLQVEADQLVGEVQGVHGQQRAPRDAPVALAQRHRQQLQLELLELLGGQVLQRIQDGVARAPHGSRIPGRCRRSPRCSRRPGGSRLRGGTWTPRLPPTLVSRLPAPVRCPPAKGASLLHPWSPPTQASGLGPQAVGGRQDRALQLACEVGPGRGPQRGSWVAPACLWACTSGYRPETWAGSHWVYWST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OsGF14e Rabbit pAb
MBS9144970-01 0.02 mL

OsGF14e Rabbit pAb

Sign In for Pricing
View Details
OsGF14e Rabbit pAb
MBS9144970-02 0.05 mL

OsGF14e Rabbit pAb

Sign In for Pricing
View Details
OsGF14e Rabbit pAb
MBS9144970-03 0.1 mL

OsGF14e Rabbit pAb

Sign In for Pricing
View Details
OsGF14e Rabbit pAb
MBS9144970-04 0.2 mL

OsGF14e Rabbit pAb

Sign In for Pricing
View Details
OsGF14e Rabbit pAb
MBS9144970-05 5x 0.2 mL

OsGF14e Rabbit pAb

Sign In for Pricing
View Details
SCARF1 Rabbit Polyclonal Antibody (APC)
orb1002813 100 µL

SCARF1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details