Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084)

This Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084) spans the amino acid sequence from region 1-186. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PiRNA-mediated silencing protein C19orf84 C19orf84

UniProt

I3L1E1

Expression Region

1-186

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRGLHRRGLGRAEQPERGRAGGPGAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAEDWETEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD6 sgRNA CRISPR Lentivector (Human) (Target 2)
K0824403 1.0 µg DNA

FXYD6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CCL14, biotinylated
50192PB-10 1 Each

Recombinant Human CCL14, biotinylated

Sign In for Pricing
View Details
NOL12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1439705 3x 1.0 µg

NOL12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-ATF7IP2 Antibody (aa318-347) IHC-plus
MBS2400312-01 0.2 mL

Anti-ATF7IP2 Antibody (aa318-347) IHC-plus

Sign In for Pricing
View Details
Anti-ATF7IP2 Antibody (aa318-347) IHC-plus
MBS2400312-02 5x 0.2 mL

Anti-ATF7IP2 Antibody (aa318-347) IHC-plus

Sign In for Pricing
View Details
9130404H23Rik 3'UTR GFP Stable Cell Line
TU150998 1.0 mL

9130404H23Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details