Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 17 (SIM17), partial

This Recombinant Human Small integral membrane protein 17 (SIM17), partial spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 17 SMIM17

UniProt

P0DL12

Expression Region

1-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2CB (Protein Phosphatase 2, Catalytic Subunit, Beta Isozyme, PP2Abeta, PP2A-beta, PP2CB, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform) (MaxLight 750)
MBS6495376-01 0.1 mL

PPP2CB (Protein Phosphatase 2, Catalytic Subunit, Beta Isozyme, PP2Abeta, PP2A-beta, PP2CB, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform) (MaxLight 750)

Sign In for Pricing
View Details
PPP2CB (Protein Phosphatase 2, Catalytic Subunit, Beta Isozyme, PP2Abeta, PP2A-beta, PP2CB, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform) (MaxLight 750)
MBS6495376-02 5x 0.1 mL

PPP2CB (Protein Phosphatase 2, Catalytic Subunit, Beta Isozyme, PP2Abeta, PP2A-beta, PP2CB, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform) (MaxLight 750)

Sign In for Pricing
View Details
FGF19 protein
MBS538309-01 0.025 mg

FGF19 protein

Sign In for Pricing
View Details
FGF19 protein
MBS538309-02 5x 0.025 mg

FGF19 protein

Sign In for Pricing
View Details
Transcriptional Enhancer Factor TEF-4 (TEAD2) Antibody
abx456163-01 50 µg

Transcriptional Enhancer Factor TEF-4 (TEAD2) Antibody

Sign In for Pricing
View Details
Transcriptional Enhancer Factor TEF-4 (TEAD2) Antibody
abx456163-02 100 µg

Transcriptional Enhancer Factor TEF-4 (TEAD2) Antibody

Sign In for Pricing
View Details