Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 17 (SIM17), partial

This Recombinant Human Small integral membrane protein 17 (SIM17), partial spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 17 SMIM17

UniProt

P0DL12

Expression Region

1-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6076 agomir
HY-R01850A-01 5 nmol

Hsa-miR-6076 agomir

Sign In for Pricing
View Details
Hsa-miR-6076 agomir
HY-R01850A-02 20 nmol

Hsa-miR-6076 agomir

Sign In for Pricing
View Details
Anti-HECW1 Polyclonal Antibody
TMAB-06964-01 50 μL

Anti-HECW1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HECW1 Polyclonal Antibody
TMAB-06964-02 100 µL

Anti-HECW1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HECW1 Polyclonal Antibody
TMAB-06964-03 200 µL

Anti-HECW1 Polyclonal Antibody

Sign In for Pricing
View Details
Potassium hydroxide Plant Culture Tested
PCT1560-5KG 5 Kg

Potassium hydroxide Plant Culture Tested

Sign In for Pricing
View Details