Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf88 (CH088)

This Recombinant Human Uncharacterized protein C8orf88 (CH088) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf88 C8orf88

UniProt

P0DMB2

Expression Region

1-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KRT6A, GST-tagged
KRT6A-469H 25 µg

Recombinant Human KRT6A, GST-tagged

Sign In for Pricing
View Details
RASGRP3 (NM_001139488) Human Tagged ORF Clone Lentiviral Particle
RC227703L3V 200 µL

RASGRP3 (NM_001139488) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ASK1 Inhibitor 10
573996 10.0mg

ASK1 Inhibitor 10

Sign In for Pricing
View Details
Rat IgG Antibody
GWB-5C08F0 1 mg

Rat IgG Antibody

Sign In for Pricing
View Details
Lentiviral human TBC1D15 shRNA (UAS) - Lentiviral human TBC1D15 shRNA (UAS, iRFP) plasmid
GTR15117496 1 Vial

Lentiviral human TBC1D15 shRNA (UAS) - Lentiviral human TBC1D15 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
3-Formylthiophene-2-carboxylic acid
OR1102526-01 50 mg

3-Formylthiophene-2-carboxylic acid

Sign In for Pricing
View Details