Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretoglobin family 1C member 2 (SG1C2)

This Recombinant Human Secretoglobin family 1C member 2 (SG1C2) spans the amino acid sequence from region 24-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretoglobin family 1C member 2 SCGB1C2

UniProt

P0DMR2

Expression Region

24-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 (mutS Homolog 2, Colon Cancer, nonpolyposis Type 1 (E. coli), COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (FITC)
248941-FITC 100 µL

MSH2 (mutS Homolog 2, Colon Cancer, nonpolyposis Type 1 (E. coli), COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (FITC)

Sign In for Pricing
View Details
OR6C4 (NM_001005494) Human Tagged ORF Clone
RG221921 10 µg

OR6C4 (NM_001005494) Human Tagged ORF Clone

Sign In for Pricing
View Details
SMC1 Blocking Peptide
MBS9617980-01 1 mg

SMC1 Blocking Peptide

Sign In for Pricing
View Details
SMC1 Blocking Peptide
MBS9617980-02 5x 1 mg

SMC1 Blocking Peptide

Sign In for Pricing
View Details
Human KRT16 Recombinant Protein
PROTP08779-20ug 20 µg

Human KRT16 Recombinant Protein

Sign In for Pricing
View Details
CDCA8, ID (CDCA8, PESCRG3, Borealin, Dasra-B, Cell division cycle-associated protein 8, Pluripotent embryonic stem cell-related gene 3 protein) (AP)
MBS6284028-01 0.2 mL

CDCA8, ID (CDCA8, PESCRG3, Borealin, Dasra-B, Cell division cycle-associated protein 8, Pluripotent embryonic stem cell-related gene 3 protein) (AP)

Sign In for Pricing
View Details