Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pro-Hyp-Gly
TRC-P592340-25MG 25 mg

Pro-Hyp-Gly

Sign In for Pricing
View Details
Kir2.1 (KCNJ2) (C-term) Rabbit Polyclonal Antibody
AP17516PU-N 400 µL

Kir2.1 (KCNJ2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44 / HCAM Std. (BU75), CF594 conjugate, 0.1mg/mL
BNC941616-100 1x 100 µL

CD44 / HCAM Std. (BU75), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(1S)-[1,1'-Binaphthalene]-2,2'-diol
TRC-B387020-5G 5 g

(1S)-[1,1'-Binaphthalene]-2,2'-diol

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF568 conjugate, 0.1mg/mL
BNC681547-500 1x 500 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPH2 Human Gene Knockout Kit (CRISPR)
KN201382LP 1 Kit

DPH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details