Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Pyrophosphatase Assay Kit
DPPT-100 100 Tests

QuantiChrom™ Pyrophosphatase Assay Kit

Sign In for Pricing
View Details
ELL Mouse Monoclonal Antibody [Clone ID: OTI3E9]
CF810825 100 µg

ELL Mouse Monoclonal Antibody [Clone ID: OTI3E9]

Sign In for Pricing
View Details
Acetylcholinesterase (AchE) Activity Assay Kit
E-BC-K174-M-01 48 T (48 samples)

Acetylcholinesterase (AchE) Activity Assay Kit

Sign In for Pricing
View Details
Acetylcholinesterase (AchE) Activity Assay Kit
E-BC-K174-M-02 96 T (96 samples)

Acetylcholinesterase (AchE) Activity Assay Kit

Sign In for Pricing
View Details
AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody
TA368691 100 µL

AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 532-Wheat Germ Agglutinin (WGA) Conjugate
25532-AAT 1 mg

IFluor® 532-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details