Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein MED14OS (M14OS)

This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1

UniProt

P0DP75

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Aclidinium Bromide
TRC-A190190-50MG 50 mg

(S)-Aclidinium Bromide

Sign In for Pricing
View Details
Slc38a5 Mouse Gene Knockout Kit (CRISPR)
KN516095 1 Kit

Slc38a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGFA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E11]
TA803421BM 100 µL

VEGFA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details
AZD2014
TRC-A808115-50MG 50 mg

AZD2014

Sign In for Pricing
View Details
WS-3-13C3
TRC-W500044-10MG 10 mg

WS-3-13C3

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details