Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein MED14OS (M14OS)

This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1

UniProt

P0DP75

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HUMAN-LDHB (Y240) Antibody
orb2630962 100 µL

HUMAN-LDHB (Y240) Antibody

Sign In for Pricing
View Details
PTGR1 Rabbit Polyclonal Antibody
TA380505 100 µL

PTGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKM2 (PKM) (NM_182471) Human Tagged Lenti ORF Clone
RC222698L1 10 µg

PKM2 (PKM) (NM_182471) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human PCED1B shRNA (UAS) - Lentiviral human PCED1B shRNA (UAS, RFP) (100)
GTR15316899 1 Vial

Lentiviral human PCED1B shRNA (UAS) - Lentiviral human PCED1B shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Magic™ Human LAG3 CHO-K1 Cell Line, Binding assay
S01YF-1022-KX156 1 Vial

Magic™ Human LAG3 CHO-K1 Cell Line, Binding assay

Sign In for Pricing
View Details
ATP5G2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV757770 1.0 µg DNA

ATP5G2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details