Recombinant Human Putative uncharacterized protein SNHG28 (SNH28)
This Recombinant Human Putative uncharacterized protein SNHG28 (SNH28) spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein SNHG28; Small nucleolar RNA host gene 2; VSIG8 overlapping transcript protein; VSIG8-OT1; SNHG28 C1orf204
UniProt
P0DPA3
Expression Region
1-235
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGMLAPGPLQGRRPRKGHKGQEDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVTLASGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
034600-AP 200 µL
DGCR14, ID (DGCR14, DGCR13, DGSH, DGSI, ES2, Protein DGCR14, DiGeorge syndrome critical region 13, DiGeorge syndrome critical region 14, DiGeorge syndrome protein H, Protein ES2) (AP) discontinued
Sign In for Pricing
View Details 
47748151 3x 1.0 µg DNA
TRIM14 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details