Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51B (CX05B)

This Recombinant Human Uncharacterized protein CXorf51B (CX05B) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51B CXorf51B

UniProt

P0DPH9

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACN9 siRNA (Human)
orb1856976-01 15 nmol

ACN9 siRNA (Human)

Sign In for Pricing
View Details
ACN9 siRNA (Human)
orb1856976-02 30 nmol

ACN9 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPAC12B10.13 Protein (aa 1-240)
VAng-Yyj6108-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe SPAC12B10.13 Protein (aa 1-240)

Sign In for Pricing
View Details
Sheep High-Sensitive Lipopolysaccharide binding protein ELISA kit
GTR10372434 96 Well

Sheep High-Sensitive Lipopolysaccharide binding protein ELISA kit

Sign In for Pricing
View Details
TROVE2/SS-A/RO60/SS Rabbit Polyclonal Antibody (Fluoro488)
orb3107948 100 µg

TROVE2/SS-A/RO60/SS Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
2,6-Dimethyl-4- (5-nitropyridin-2-yl) morpholine
OR1065189-01 250 mg

2,6-Dimethyl-4- (5-nitropyridin-2-yl) morpholine

Sign In for Pricing
View Details