Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1200002N14Rik (BC021433) Mouse Tagged ORF Clone
MG200764 10 µg

1200002N14Rik (BC021433) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NADK (NM_001198994) Human Recombinant Protein
TP720242XL 1 mg

NADK (NM_001198994) Human Recombinant Protein

Sign In for Pricing
View Details
LRG1 Human Knockdown Lysate
LY300230 100 µg

LRG1 Human Knockdown Lysate

Sign In for Pricing
View Details
ZIC4 (NM_001168378) Human Over-expression Lysate
LY432971 100 µg

ZIC4 (NM_001168378) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS629192 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Protein G Colloidal Gold, 1mL 10nm
GP-02-10 1 mL

Protein G Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details