Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTLA (B and T Lymphocyte Associated, BTLA1, CD272, FLJ16065, MGC129743) (HRP)
243916-HRP 100 µL

BTLA (B and T Lymphocyte Associated, BTLA1, CD272, FLJ16065, MGC129743) (HRP)

Sign In for Pricing
View Details
KCNAB1-AS1 AAV Vector (Human) (CMV)
25333101 1 µg

KCNAB1-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
WDR51A Protein Vector (Human) (pPB-C-His)
PV059769 500 ng

WDR51A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Olr1553 AAV Vector (Rat) (CMV)
34031106 1 µg

Olr1553 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
CHIKV-E2 Protein (C-His, CHIKV)
P520869 100 µg

CHIKV-E2 Protein (C-His, CHIKV)

Sign In for Pricing
View Details
MAT2A Rabbit Polyclonal Antibody (BF405)
orb2424952 100 µL

MAT2A Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details