Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATL1 siRNA (Human)
CRJ6444-01 15 nmol

PATL1 siRNA (Human)

Sign In for Pricing
View Details
PATL1 siRNA (Human)
CRJ6444-02 30 nmol

PATL1 siRNA (Human)

Sign In for Pricing
View Details
Leng8-set siRNA/shRNA/RNAi Lentivector (Mouse)
26439094 4x 500 ng

Leng8-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
RBM3 Human Over-expression Lysate
orb1357255 100 µg

RBM3 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal B7-1/CD80 Antibody (C80/1608)
NBP2-53176-20ug 20 µg

Mouse Monoclonal B7-1/CD80 Antibody (C80/1608)

Sign In for Pricing
View Details
1- (4-Bromo-2,5-dimethoxybenzyl) piperazine
FB19070-01 10 mg

1- (4-Bromo-2,5-dimethoxybenzyl) piperazine

Sign In for Pricing
View Details