Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTTG1IP family member 2 (PTIP2), partial

This Recombinant Human PTTG1IP family member 2 (PTIP2), partial spans the amino acid sequence from region 27-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTTG1IP family member 2 PTTG1IP2

UniProt

P0DTF9

Expression Region

27-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FSENGFIHSPRNNQKPRDGNEEECAVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-C6ORF154 antibody
SL15226R-01 50 µL

Rabbit Anti-C6ORF154 antibody

Sign In for Pricing
View Details
Rabbit Anti-C6ORF154 antibody
SL15226R-02 100 µL

Rabbit Anti-C6ORF154 antibody

Sign In for Pricing
View Details
ARFRP1 (NM_001267549) Human Tagged ORF Clone
RG231959 10 µg

ARFRP1 (NM_001267549) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hsa-miR-6728-3p miRNA Mimic
orb1876633-01 5 nmol

Hsa-miR-6728-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6728-3p miRNA Mimic
orb1876633-02 10 nmol

Hsa-miR-6728-3p miRNA Mimic

Sign In for Pricing
View Details
ATP Synthase Subunit D, Mitochondrial (ATP5PD) Antibody
abx025624-01 80 µL

ATP Synthase Subunit D, Mitochondrial (ATP5PD) Antibody

Sign In for Pricing
View Details